U2AF35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35321

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF35 (NP_006749.1).

Sequence:
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for U2AF35 Antibody - BSA Free

U2AF35 Antibody

Immunohistochemistry: U2AF35 Antibody [NBP3-35321] -

Immunohistochemistry: U2AF35 Antibody [NBP3-35321] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using U2AF35 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
U2AF35 Antibody

Immunoprecipitation: U2AF35 Antibody [NBP3-35321] -

Immunoprecipitation: U2AF35 Antibody [NBP3-35321] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug U2AF35 antibody. Western blot was performed from the immunoprecipitate using U2AF35 antibody at a dilution of 1:1000.
U2AF35 Antibody

Western Blot: U2AF35 Antibody [NBP3-35321] -

Western Blot: U2AF35 Antibody [NBP3-35321] - Western blot analysis of various lysates using U2AF35 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for U2AF35 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:100 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: U2AF35

U2AF35 belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Alternate Names

FP793, human U2 snRNP auxiliary factor small subunit10U2AF35DKFZp313J1712, RN, RNU2AF1,35-KD subunit, U2 auxiliary factor 35 kDa subunit, U2 small nuclear RNA auxiliary factor 1, U2 small nuclear RNA auxillary factor 1, U2 snRNP auxiliary factor small subunit

Gene Symbol

U2AF1

Additional U2AF35 Products

Product Documents for U2AF35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for U2AF35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for U2AF35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review U2AF35 Antibody - BSA Free and earn rewards!

Have you used U2AF35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...