UbcH5a/UBE2D1 Antibody (8E6O0)

Novus Biologicals | Catalog # NBP3-33268

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8E6O0
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 50-147 of human UbcH5a/UBE2D1 (NP_003329.1).

Sequence:
FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit UbcH5a/UBE2D1 Antibody (8E6O0) (NBP3-33268) is a monoclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for UbcH5a/UBE2D1 Antibody (8E6O0)

UbcH5a/UBE2D1 Antibody (8E6O0)

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
UbcH5a/UBE2D1 Antibody (8E6O0)

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
UbcH5a/UBE2D1 Antibody (8E6O0)

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -

Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for UbcH5a/UBE2D1 Antibody (8E6O0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UbcH5a/UBE2D1

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Alternate Names

E2(17)KB1, UBC4/5, UBC5A, UBE2D1

Gene Symbol

UBE2D1

Additional UbcH5a/UBE2D1 Products

Product Documents for UbcH5a/UBE2D1 Antibody (8E6O0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UbcH5a/UBE2D1 Antibody (8E6O0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH5a/UBE2D1 Antibody (8E6O0)

There are currently no reviews for this product. Be the first to review UbcH5a/UBE2D1 Antibody (8E6O0) and earn rewards!

Have you used UbcH5a/UBE2D1 Antibody (8E6O0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail