UbcH5a/UBE2D1 Antibody (8E6O0)
Novus Biologicals | Catalog # NBP3-33268
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 8E6O0
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-147 of human UbcH5a/UBE2D1 (NP_003329.1).
Sequence:
FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Sequence:
FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit UbcH5a/UBE2D1 Antibody (8E6O0) (NBP3-33268) is a monoclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for UbcH5a/UBE2D1 Antibody (8E6O0)
Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -
Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -
Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] -
Immunohistochemistry: UbcH5a/UBE2D1 Antibody (8E6O0) [NBP3-33268] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using UbcH5a/UBE2D1 Rabbit mAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for UbcH5a/UBE2D1 Antibody (8E6O0)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunohistochemistry-Paraffin
1:50 - 1:200
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: UbcH5a/UBE2D1
Alternate Names
E2(17)KB1, UBC4/5, UBC5A, UBE2D1
Gene Symbol
UBE2D1
Additional UbcH5a/UBE2D1 Products
Product Documents for UbcH5a/UBE2D1 Antibody (8E6O0)
Product Specific Notices for UbcH5a/UBE2D1 Antibody (8E6O0)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for UbcH5a/UBE2D1 Antibody (8E6O0)
There are currently no reviews for this product. Be the first to review UbcH5a/UBE2D1 Antibody (8E6O0) and earn rewards!
Have you used UbcH5a/UBE2D1 Antibody (8E6O0)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...