UBE2N/Ubc13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48823

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit UBE2N/Ubc13 Antibody - BSA Free (NBP2-48823) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for UBE2N/Ubc13 Antibody - BSA Free

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823]

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823]

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunocytochemistry/ Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunocytochemistry/Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823] - Immunofluorescent staining of human cell line RT4 shows localization to nucleus.
Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823] - Staining in human testis and pancreas tissues using anti-UBE2N antibody. Corresponding UBE2N RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823] - Staining of human testis shows high expression.

Applications for UBE2N/Ubc13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2N/Ubc13

UBC13 is a member of the E2 ubiquitin-conjugating enzyme family also known as Ubiquitin-conjugating enzyme E2 N, Ubiquitin-protein ligase N, Ubiquitin carrier protein N and Bendless-like ubiquitin-conjugating enzyme. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. UBC13 forms a heterodimer with UBE2V2 which then catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. UBC13 also mediates transcriptional activation of target genes and plays a role in the control of progress through the cell cycle and differentiation, as well as error-free DNA repair. UBC13 also contributes to the survival of cells after DNA damage.

Alternate Names

BLU, UBC13, UbcH13, UBE2N

Gene Symbol

UBE2N

Additional UBE2N/Ubc13 Products

Product Documents for UBE2N/Ubc13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2N/Ubc13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for UBE2N/Ubc13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2N/Ubc13 Antibody - BSA Free and earn rewards!

Have you used UBE2N/Ubc13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail