USP33 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35652

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).

Sequence:
QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for USP33 Antibody - BSA Free

USP33 Antibody

Immunocytochemistry/ Immunofluorescence: USP33 Antibody [NBP3-35652] -

Immunocytochemistry/ Immunofluorescence: USP33 Antibody [NBP3-35652] - Immunofluorescence analysis of NIH-3T3 cells using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
USP33 Antibody

Immunohistochemistry: USP33 Antibody [NBP3-35652] -

Immunohistochemistry: USP33 Antibody [NBP3-35652] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
USP33 Antibody

Western Blot: USP33 Antibody [NBP3-35652] -

Western Blot: USP33 Antibody [NBP3-35652] - Western blot analysis of lysates from HeLa cells, using USP33 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1min.
USP33 Antibody

Immunohistochemistry: USP33 Antibody [NBP3-35652] -

Immunohistochemistry: USP33 Antibody [NBP3-35652] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
USP33 Antibody

Western Blot: USP33 Antibody [NBP3-35652] -

Western Blot: USP33 Antibody [NBP3-35652] - Western blot analysis of lysates from HepG2 cells, using USP33 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.

Applications for USP33 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: USP33

The ubiquitin dependent protein degradation pathway is essential for the proteolysis of intracellular proteins and peptides. Deubiquitination, is catalyzed by proteases called deubiquitinating enzymes. USP33 is a deubiquitinating enzyme that binds to the von Hippel-Lindau tumor suppressor protein. It also regulates thyroid hormone activation by deubiquitinating type 2 iodothyronine deiodinase.

Long Name

Ubiquitin carboxyl-terminal hydrolase 33

Alternate Names

hVDU1, KIAA1097, VDU1

Gene Symbol

USP33

Additional USP33 Products

Product Documents for USP33 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for USP33 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for USP33 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP33 Antibody - BSA Free and earn rewards!

Have you used USP33 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...