VARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38079

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VARS Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human VARS (NP_006286.1).

Sequence:
MSTLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPALEQGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALGLRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPEAPALPKTAAQLKKEAKKREKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

140 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VARS Antibody - BSA Free

VARS Antibody

Immunohistochemistry: VARS Antibody [NBP3-38079] -

Immunohistochemistry: VARS Antibody [NBP3-38079] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using VARS Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
VARS Antibody

Immunohistochemistry: VARS Antibody [NBP3-38079] -

Immunohistochemistry: VARS Antibody [NBP3-38079] - Immunohistochemistry analysis of paraffin-embedded Rat brain using VARS Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
VARS Antibody

Immunocytochemistry/ Immunofluorescence: VARS Antibody [NBP3-38079] -

Immunocytochemistry/ Immunofluorescence: VARS Antibody [NBP3-38079] - Immunofluorescence analysis of L929 cells using VARS Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
VARS Antibody

Western Blot: VARS Antibody [NBP3-38079] -

Western Blot: VARS Antibody [NBP3-38079] - Western blot analysis of various lysates using VARS Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
VARS Antibody

Immunohistochemistry: VARS Antibody [NBP3-38079] -

Immunohistochemistry: VARS Antibody [NBP3-38079] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using VARS Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for VARS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VARS

VARS - valyl-tRNA synthetase

Alternate Names

EC 6.1.1, EC 6.1.1.9, G7AVARS1, Protein G7a, valine tRNA ligase 1, cytoplasmic, Valine--tRNA ligase, ValRS, valyl-tRNA synthetase, valyl-tRNA synthetase 2, VARS2valRS

Gene Symbol

VARS1

Additional VARS Products

Product Documents for VARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VARS Antibody - BSA Free and earn rewards!

Have you used VARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies