Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Predicted:
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for VGLL4 Antibody - BSA Free
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421]
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Positive staining can be observed in the nuclears of gastric epithelial cells. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421]
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Staining of human prostate shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human endometrium shows weak nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human liver shows no positivity in hepatocytes as expected.Applications for VGLL4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP2-38421 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: VGLL4
Alternate Names
KIAA0121transcription cofactor vestigial-like protein 4, vestigial like 4 (Drosophila), Vestigial-like 4, Vgl-4
Gene Symbol
VGLL4
UniProt
Additional VGLL4 Products
Product Documents for VGLL4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for VGLL4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for VGLL4 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used VGLL4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Stomach tissueSpecies: HumanVerified Customer | Posted 09/22/2017Positive staining can be observed in the nuclears of gastric epithelial cells
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...