Vitamin D BP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88027

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL

Reactivity Notes

Equine reactivity reported from a verified by customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Vitamin D BP Antibody - BSA Free

Western Blot: Vitamin D BP Antibody [NBP1-88027]

Western Blot: Vitamin D BP Antibody [NBP1-88027]

Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027]

Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027]

Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.
Vitamin D BP Antibody - BSA Free Western Blot: Vitamin D BP Antibody - BSA Free [NBP1-88027]

Western Blot: Vitamin D BP Antibody - BSA Free [NBP1-88027]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Vitamin D BP Antibody - BSA Free Western Blot: Vitamin D BP Antibody - BSA Free [NBP1-88027]

Western Blot: Vitamin D BP Antibody - BSA Free [NBP1-88027]

Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).
Vitamin D BP Antibody - BSA Free

Western Blot: Vitamin D BP Antibody - BSA Free [NBP1-88027] -

Legumain is required for VDBP processing and regulation. (A) Purified VDBP from human plasma (1.9 μM) was incubated in legumain assay buffer (pH 5.8) at 37 C with or without purified active bovine legumain (2 μM) for 5 h before gel electrophoresis and immunoblotting of VDBP (n = 1). (B–H) Wild-type (Lgmn+/+) and legumain-deficient (Lgmn−/−) mice were treated with 50 ug/kg 25(OH)D3 (n = 6–7) or an equal volume vehicle (n = 7, control) subcutaneously every two to three days (four times in total). Tissues were harvested 24 h after the final injection (day 8). (B) One representative immunoblot of VDBP and GAPDH (housekeeping) in kidney and liver (n = 4). (C–F) Quantification of VDBP immunoband (IB) intensity as arbitrary units (ARBU) relative to GAPDH in immunoblots represented in (B) (n = 4). (C) Hepatic VDBP 45 kDa immunoband. (D) Renal VDBP 45 kDa immunoband. (E) Hepatic VDBP 55 kDa immunoband. (F) Renal VDBP 55 kDa immunoband. (G) Plasma VDBP concentration (μg/mL) was measured by ELISA (n = 6–7). (H) Hepatic VDBP mRNA expression relative to the geometric mean of CT values of four housekeeping controls (2− delta delta CT, n = 5). (C–H) Data represent mean +/- SEM. Two-way ANOVA. # p < 0.05, ## p < 0.01, ### p < 0.001 vs. different genotype, same treatment. Numbers (n) represent individual biological replicates. Image collected and cropped by CiteAb from the following open publication (https://www.mdpi.com/2073-4409/13/1/36), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Vitamin D BP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Vitamin D BP antibody validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: separated by Size

Reviewed Applications

Read 2 reviews rated 5 using NBP1-88027 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Vitamin D BP

Vitamin D Binding Protein is a secreted multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and urine, and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane bound immunoglobulin on the surface of B lymphocytes and with IgG fc receptor on the membranes of T lymphocytes.

Long Name

Vitamin D Binding Protein

Alternate Names

DBP, DBP-MAF, Gc, Gc-MAF, VDBG, VDBP

Gene Symbol

GC

Additional Vitamin D BP Products

Product Documents for Vitamin D BP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Vitamin D BP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Vitamin D BP Antibody - BSA Free

Customer Reviews for Vitamin D BP Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Vitamin D BP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 2 的 2 reviews Showing All
Filter By:
  • Vitamin D BP Antibody
    Name: Shavahn Loux
    Application: Western Blot
    Sample Tested: Liver and Embryonic liver
    Species: Equine
    Verified Customer | Posted 02/02/2020
    !:3000 dilution
    Vitamin D BP Antibody - BSA Free NBP1-88027
  • Vitamin D BP Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: Serum
    Species: Rat
    Verified Customer | Posted 05/25/2017

There are no reviews that match your criteria.

Showing  1 - 2 的 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Vitamin D BP Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: Does vitamin d binding protein have both nuclear and cytoplasmic staining?

    A: From the image on our website, NBP1-88027 shows cytoplasmic staining. Furthermore, as Vitamin D binding protein is secreted, nuclear staining would not be expected.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...