WDHD1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89091
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for WDHD1 Antibody - BSA Free
Western Blot: WDHD1 Antibody [NBP1-89091]
Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091]
Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.Western Blot: WDHD1 Antibody [NBP1-89091]
Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in human cell line RH-30.Western Blot: WDHD1 Antibody [NBP1-89091]
WDHD1-Antibody-Western-Blot-NBP1-89091-img0018.jpgWestern Blot: WDHD1 Antibody [NBP1-89091] -
Western Blot: WDHD1 Antibody [NBP1-89091] - DDX11 interacts with Pol delta independently of its FeS cluster.(A) Gene Ontology term enrichment analysis of interaction partners obtained upon pull-down of YFP-DDX11 from HeLa Flp-In T-REx cells. (B) Flag pull-down of over-expressed Flag-tagged DDX11 from 293T cells & co-immunoprecipitated endogenous proteins. (C) Reciprocal co-immunoprecipitations of Flag-tagged POLD1 & untagged DDX11, & Flag-tagged DDX11 & untagged POLD1, respectively, extracted from 293T cells. (D) Co-immunoprecipitations of Flag-tagged DDX11 variants & untagged POLD1 from 293T cells. See also Fig S3, Tables S1, & S2. WB, Western blot. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32071282), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WDHD1 Antibody [NBP1-89091] -
Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] -
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WDHD1 Antibody [NBP1-89091] -
Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]
Staining of human lymph node shows strong nuclear positivity in germinal center cells.Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]
Staining of human rectum shows strong nuclear positivity in glandular cells.Applications for WDHD1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 5 using NBP1-89091 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: WDHD1
Alternate Names
Acidic nucleoplasmic DNA-binding protein 1, AND1, And-1, CHTF4, CTF4, CTF4, chromosome transmission fidelity factor 4 homolog, WD repeat and HMG-box DNA binding protein 1, WD repeat and HMG-box DNA-binding protein 1
Entrez Gene IDs
11169 (Human)
Gene Symbol
WDHD1
UniProt
Additional WDHD1 Products
Product Documents for WDHD1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for WDHD1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for WDHD1 Antibody - BSA Free
Customer Reviews for WDHD1 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used WDHD1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Whole cell lysatesSpecies: HumanVerified Customer | Posted 11/11/2014WDHD-1 in Cell lysates
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...