WDHD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89091

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WDHD1 Antibody - BSA Free

Western Blot: WDHD1 Antibody [NBP1-89091]

Western Blot: WDHD1 Antibody [NBP1-89091]

Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091]

Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091]

Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: WDHD1 Antibody [NBP1-89091]

Western Blot: WDHD1 Antibody [NBP1-89091]

Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in human cell line RH-30.
Western Blot: WDHD1 Antibody [NBP1-89091]

Western Blot: WDHD1 Antibody [NBP1-89091]

WDHD1-Antibody-Western-Blot-NBP1-89091-img0018.jpg
WDHD1 Antibody

Western Blot: WDHD1 Antibody [NBP1-89091] -

Western Blot: WDHD1 Antibody [NBP1-89091] - DDX11 interacts with Pol delta independently of its FeS cluster.(A) Gene Ontology term enrichment analysis of interaction partners obtained upon pull-down of YFP-DDX11 from HeLa Flp-In T-REx cells. (B) Flag pull-down of over-expressed Flag-tagged DDX11 from 293T cells & co-immunoprecipitated endogenous proteins. (C) Reciprocal co-immunoprecipitations of Flag-tagged POLD1 & untagged DDX11, & Flag-tagged DDX11 & untagged POLD1, respectively, extracted from 293T cells. (D) Co-immunoprecipitations of Flag-tagged DDX11 variants & untagged POLD1 from 293T cells. See also Fig S3, Tables S1, & S2. WB, Western blot. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32071282), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody

Western Blot: WDHD1 Antibody [NBP1-89091] -

Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody

Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] -

Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody

Western Blot: WDHD1 Antibody [NBP1-89091] -

Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody - BSA Free Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Analysis in human testis and liver tissues. Corresponding RNA-seq data are presented for the same tissues.
WDHD1 Antibody - BSA Free Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
WDHD1 Antibody - BSA Free Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Staining of human liver shows no positivity in hepatocytes as expected.
WDHD1 Antibody - BSA Free Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Staining of human lymph node shows strong nuclear positivity in germinal center cells.
WDHD1 Antibody - BSA Free Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091]

Staining of human rectum shows strong nuclear positivity in glandular cells.

Applications for WDHD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-89091 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDHD1

WDHD1 is encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

Acidic nucleoplasmic DNA-binding protein 1, AND1, And-1, CHTF4, CTF4, CTF4, chromosome transmission fidelity factor 4 homolog, WD repeat and HMG-box DNA binding protein 1, WD repeat and HMG-box DNA-binding protein 1

Entrez Gene IDs

11169 (Human)

Gene Symbol

WDHD1

UniProt

Additional WDHD1 Products

Product Documents for WDHD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDHD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for WDHD1 Antibody - BSA Free

Customer Reviews for WDHD1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used WDHD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 11 review Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Whole cell lysates
    Species: Human
    Verified Customer | Posted 11/11/2014
    WDHD-1 in Cell lysates

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...