WDHD1 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-93674
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 830-1129 of human WDHD1 (NP_009017.1). EEEEEEDFRKKLNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for WDHD1 Antibody - Azide and BSA Free
Western Blot: WDHD1 AntibodyAzide and BSA Free [NBP2-93674]
Western Blot: WDHD1 Antibody [NBP2-93674] - Analysis of extracts of various cell lines, using WDHD1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]
Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP2-93674] - Analysis of U-2 OS cells using WDHD1 at dilution of 1:100. Blue: DAPI for nuclear staining.Immunohistochemistry-Paraffin: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP2-93674] - Human esophageal cancer using WDHD1 Rabbit pAb at dilution of 1:100 (40x lens).Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -
DNA demethylases TET1/TET3 activates WDHD1 in LUAD cells. (A) The level of WDHD1 promoter methylation in LUAD cells (H1944, A549, PC-9, and H1975 cells) and the human bronchial epithelial cell line (BEAS-2B) was examined using qMSP. (B) The protein expression of TET1, TET2, and TET3 in LUAD cells (H1944, A549, PC-9, and H1975 cells) and BEAS-2B cells was examined using western blot analysis. (C) The methylation of the WDHD1 promoter in tumors and paracancerous tissues of 16 LUAD patients was examined using qMSP. (D) The protein expression of TET1 and TET3 in tumors and paracancerous tissues of 16 LUAD patients was examined using western blot analysis. (E) Transcriptional levels of WDHD1, TET1, and TET3 in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 were examined using RT-qPCR. (F) The protein expression of WDHD1, TET1, and TET3 in LUAD cells after infection with KD-TET1 or KD-TET3 was examined using western blot analysis. (G) The level of WDHD1 promoter methylation in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 was examined using qMSP. p-values were calculated using paired t-tests or two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -
Exogenous expression of WDHD1 reverses knockdown of TET1/TET3-blocked LUAD glycolysis. (A) Transcriptional levels of WDHD1 in A549 and PC-9 cells after infection of KD-TET1 + OE-WDHD1 or KD-TET3 + OE-WDHD1 were examined using RT-qPCR. (B) The protein expression of WDHD1 in LUAD cells after infection of KD-TET1 + OE-WDHD1 or KD-TET3 + OE-WDHD1 was examined using western blot analysis. Glycolytic activity and capacity of A549 (C) and PC-9 (D) cells were analyzed. (E) Detection of 2,3-BPG contents in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1 by ELISA. (F) Detection of 2-PG in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1 by ELISA. (G) Lactate production in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1. p-values were calculated using two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -
DNA demethylases TET1/TET3 activates WDHD1 in LUAD cells. (A) The level of WDHD1 promoter methylation in LUAD cells (H1944, A549, PC-9, and H1975 cells) and the human bronchial epithelial cell line (BEAS-2B) was examined using qMSP. (B) The protein expression of TET1, TET2, and TET3 in LUAD cells (H1944, A549, PC-9, and H1975 cells) and BEAS-2B cells was examined using western blot analysis. (C) The methylation of the WDHD1 promoter in tumors and paracancerous tissues of 16 LUAD patients was examined using qMSP. (D) The protein expression of TET1 and TET3 in tumors and paracancerous tissues of 16 LUAD patients was examined using western blot analysis. (E) Transcriptional levels of WDHD1, TET1, and TET3 in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 were examined using RT-qPCR. (F) The protein expression of WDHD1, TET1, and TET3 in LUAD cells after infection with KD-TET1 or KD-TET3 was examined using western blot analysis. (G) The level of WDHD1 promoter methylation in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 was examined using qMSP. p-values were calculated using paired t-tests or two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for WDHD1 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Western Blot
1:200-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: WDHD1
Alternate Names
Acidic nucleoplasmic DNA-binding protein 1, AND1, And-1, CHTF4, CTF4, CTF4, chromosome transmission fidelity factor 4 homolog, WD repeat and HMG-box DNA binding protein 1, WD repeat and HMG-box DNA-binding protein 1
Gene Symbol
WDHD1
Additional WDHD1 Products
Product Documents for WDHD1 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for WDHD1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for WDHD1 Antibody - Azide and BSA Free
Customer Reviews for WDHD1 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review WDHD1 Antibody - Azide and BSA Free and earn rewards!
Have you used WDHD1 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...