WDHD1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93674

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 830-1129 of human WDHD1 (NP_009017.1). EEEEEEDFRKKLNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WDHD1 Antibody - Azide and BSA Free

Western Blot: WDHD1 AntibodyAzide and BSA Free [NBP2-93674]

Western Blot: WDHD1 AntibodyAzide and BSA Free [NBP2-93674]

Western Blot: WDHD1 Antibody [NBP2-93674] - Analysis of extracts of various cell lines, using WDHD1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]

Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]

Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP2-93674] - Analysis of U-2 OS cells using WDHD1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]

Immunohistochemistry-Paraffin: WDHD1 Antibody - Azide and BSA Free [NBP2-93674]

Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP2-93674] - Human esophageal cancer using WDHD1 Rabbit pAb at dilution of 1:100 (40x lens).
WDHD1 Antibody - Azide and BSA Free

Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -

DNA demethylases TET1/TET3 activates WDHD1 in LUAD cells. (A) The level of WDHD1 promoter methylation in LUAD cells (H1944, A549, PC-9, and H1975 cells) and the human bronchial epithelial cell line (BEAS-2B) was examined using qMSP. (B) The protein expression of TET1, TET2, and TET3 in LUAD cells (H1944, A549, PC-9, and H1975 cells) and BEAS-2B cells was examined using western blot analysis. (C) The methylation of the WDHD1 promoter in tumors and paracancerous tissues of 16 LUAD patients was examined using qMSP. (D) The protein expression of TET1 and TET3 in tumors and paracancerous tissues of 16 LUAD patients was examined using western blot analysis. (E) Transcriptional levels of WDHD1, TET1, and TET3 in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 were examined using RT-qPCR. (F) The protein expression of WDHD1, TET1, and TET3 in LUAD cells after infection with KD-TET1 or KD-TET3 was examined using western blot analysis. (G) The level of WDHD1 promoter methylation in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 was examined using qMSP. p-values were calculated using paired t-tests or two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody - Azide and BSA Free

Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -

Exogenous expression of WDHD1 reverses knockdown of TET1/TET3-blocked LUAD glycolysis. (A) Transcriptional levels of WDHD1 in A549 and PC-9 cells after infection of KD-TET1 + OE-WDHD1 or KD-TET3 + OE-WDHD1 were examined using RT-qPCR. (B) The protein expression of WDHD1 in LUAD cells after infection of KD-TET1 + OE-WDHD1 or KD-TET3 + OE-WDHD1 was examined using western blot analysis. Glycolytic activity and capacity of A549 (C) and PC-9 (D) cells were analyzed. (E) Detection of 2,3-BPG contents in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1 by ELISA. (F) Detection of 2-PG in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1 by ELISA. (G) Lactate production in A549 and PC-9 cells after infection of KD-TET1 or KD-TET3 alone or combined with OE-WDHD1. p-values were calculated using two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WDHD1 Antibody - Azide and BSA Free

Western Blot: WDHD1 Antibody - Azide and BSA Free [NBP2-93674] -

DNA demethylases TET1/TET3 activates WDHD1 in LUAD cells. (A) The level of WDHD1 promoter methylation in LUAD cells (H1944, A549, PC-9, and H1975 cells) and the human bronchial epithelial cell line (BEAS-2B) was examined using qMSP. (B) The protein expression of TET1, TET2, and TET3 in LUAD cells (H1944, A549, PC-9, and H1975 cells) and BEAS-2B cells was examined using western blot analysis. (C) The methylation of the WDHD1 promoter in tumors and paracancerous tissues of 16 LUAD patients was examined using qMSP. (D) The protein expression of TET1 and TET3 in tumors and paracancerous tissues of 16 LUAD patients was examined using western blot analysis. (E) Transcriptional levels of WDHD1, TET1, and TET3 in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 were examined using RT-qPCR. (F) The protein expression of WDHD1, TET1, and TET3 in LUAD cells after infection with KD-TET1 or KD-TET3 was examined using western blot analysis. (G) The level of WDHD1 promoter methylation in A549 and PC-9 cells after infection with KD-TET1 or KD-TET3 was examined using qMSP. p-values were calculated using paired t-tests or two-way ANOVA. Mean +/- SEM was presented. The average results from five independent experiments are shown Image collected and cropped by CiteAb from the following open publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for WDHD1 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:200-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: WDHD1

WDHD1 is encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

Acidic nucleoplasmic DNA-binding protein 1, AND1, And-1, CHTF4, CTF4, CTF4, chromosome transmission fidelity factor 4 homolog, WD repeat and HMG-box DNA binding protein 1, WD repeat and HMG-box DNA-binding protein 1

Gene Symbol

WDHD1

Additional WDHD1 Products

Product Documents for WDHD1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDHD1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for WDHD1 Antibody - Azide and BSA Free

Customer Reviews for WDHD1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WDHD1 Antibody - Azide and BSA Free and earn rewards!

Have you used WDHD1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...