Wnt-5a Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60032

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to WNT5A(wingless-type MMTV integration site family, member 5A) The peptide sequence was selected from the middle region of WNT5A. Peptide sequence GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29563288).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Wnt-5a Antibody - BSA Free

Western Blot: Wnt-5a Antibody [NBP1-60032]

Western Blot: Wnt-5a Antibody [NBP1-60032]

Western Blot: Wnt-5a Antibody [NBP1-60032] - Hela Cell Lysate 1.0 ug/ml, gel concentration 12%
Immunohistochemistry: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry: Wnt-5a Antibody [NBP1-60032] - Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.
Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032]

Immunohistochemistry-Paraffin: Wnt-5a Antibody [NBP1-60032] - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

Applications for Wnt-5a Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Wnt-5a

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Wingless-type MMTV Integration Site Family, Member 5a

Alternate Names

Wnt5a

Gene Symbol

WNT5A

UniProt

Additional Wnt-5a Products

Product Documents for Wnt-5a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Wnt-5a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Wnt-5a Antibody - BSA Free

Customer Reviews for Wnt-5a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Wnt-5a Antibody - BSA Free and earn rewards!

Have you used Wnt-5a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies