ZDHHC18 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94111

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ZDHHC18 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1). YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZDHHC18 Antibody - Azide and BSA Free

Western Blot: ZDHHC18 AntibodyAzide and BSA Free [NBP2-94111]

Western Blot: ZDHHC18 AntibodyAzide and BSA Free [NBP2-94111]

Western Blot: ZDHHC18 Antibody [NBP2-94111] - Analysis of extracts of various cell lines, using ZDHHC18 Rabbit pAb at 1:1000dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk inTBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry-Paraffin: ZDHHC18 Antibody - Azide and BSA Free [NBP2-94111]

Immunohistochemistry-Paraffin: ZDHHC18 Antibody - Azide and BSA Free [NBP2-94111]

Immunohistochemistry-Paraffin: ZDHHC18 Antibody [NBP2-94111] - Paraffin-embedded human lung cancer using ZDHHC18.

Applications for ZDHHC18 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is ug/mL

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZDHHC18

ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK

Alternate Names

DHHC domain containing 18, DHHC18, DHHC-18, EC 2.3.1, EC 2.3.1.-, zinc finger, DHHC-type containing 18

Gene Symbol

ZDHHC18

Additional ZDHHC18 Products

Product Documents for ZDHHC18 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZDHHC18 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ZDHHC18 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZDHHC18 Antibody - Azide and BSA Free and earn rewards!

Have you used ZDHHC18 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies