ZMAT4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49619

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYH

Reactivity Notes

Rat (84%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZMAT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Analysis in human thyroid gland and skin tissues. Corresponding ZMAT4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human cerebral cortex shows weak to moderate positivity in neurons.
Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human thyroid gland shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619]

Immunohistochemistry-Paraffin: ZMAT4 Antibody [NBP2-49619] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
ZMAT4 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZMAT4 Antibody - BSA Free [NBP2-49619]

Chromatin Immunoprecipitation-exo-Seq: ZMAT4 Antibody - BSA Free [NBP2-49619]

ChIP-Exo-Seq composite graph for Anti-ZMAT4 (NBP2-49619) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZMAT4 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZMAT4

ZMAT4, also known as Zinc finger matrin-type protein 4, has a 229 amino acid long isoform that is 26 kDa and a short 153 amino acid isoform that is approx. 17 kDa. This protein commonly found in the nucleus, is related to DNA binding, metal ion binding and zinc ion binding.

Alternate Names

FLJ13842, zinc finger matrin-type protein 4, zinc finger, matrin type 4, zinc finger, matrin-type 4

Gene Symbol

ZMAT4

Additional ZMAT4 Products

Product Documents for ZMAT4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZMAT4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZMAT4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZMAT4 Antibody - BSA Free and earn rewards!

Have you used ZMAT4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...