ZNF24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82866

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF24 Antibody - BSA Free

Western Blot: ZNF24 Antibody [NBP1-82866]

Western Blot: ZNF24 Antibody [NBP1-82866]

Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866]

Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866]

Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.
Western Blot: ZNF24 Antibody [NBP1-82866]

Western Blot: ZNF24 Antibody [NBP1-82866]

Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image submitted by a verified customer review.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. ZNF24 and PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. PD-L1 expression was suppressed following the ZNF24 knockdown. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575/) licensed under a CC-BY license.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

ROS/ZNF24/PD-L1 pathway activation in NAFLD models. (a) Intracellular ROS in hepatocytes in NAFLD significantly increased. (b) JC-1 probes were used to detect mitochondrial membrane potential. (c & d) NOX4 & ZNF24 expressions were determined by immunohistochemistry. (e & f) ROS/ZNF24/PD-L1 pathway activation examined by western blot. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF24 Antibody

Western Blot: ZNF24 Antibody [NBP1-82866] -

Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ZNF24 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-82866 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF24

ZNF24 may function as a transcription factor. Seems to repress transcription

Long Name

Zinc Finger Protein 24

Alternate Names

KOX17, RSG-A, Zfp191, ZSCAN3

Gene Symbol

ZNF24

Additional ZNF24 Products

Product Documents for ZNF24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ZNF24 Antibody - BSA Free

Customer Reviews for ZNF24 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ZNF24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Name: Andres J Lopez-Contreras
    Application: Western Blot
    Sample Tested: 293t HEK and U2OS cells
    Species: Human
    Verified Customer | Posted 06/03/2013
    ZNF24 Antibody - BSA Free NBP1-82866

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...