14-3-3 sigma/Stratifin Antibody (8C8A9)

Novus Biologicals | Catalog # NBP3-16395

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8C8A9 expressed in HEK293
View all 14-3-3 sigma Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma/Stratifin (P31947). MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 sigma/Stratifin Antibody (8C8A9)

Western Blot: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395]

Western Blot: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395]

Western Blot: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395] - Western blot analysis of extracts of various cell lines, using 14-3-3 sigma/Stratifin Rabbit mAb (NBP3-16395) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395]

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395]

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody (8C8A9) [NBP3-16395] - Immunohistochemistry of paraffin-embedded human colon using 14-3-3 sigma/Stratifin Rabbit mAb (NBP3-16395) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for 14-3-3 sigma/Stratifin Antibody (8C8A9)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 sigma

14-3-3 sigma was identified as an epithelial cell marker. It is part of the 14-3-3 family of proteins in which seven isoforms have been identified: beta, zeta, gamma, eta, epsilon, tau, and sigma. 14-3-3 proteins function as adaptors that bind with a number of partners to mediate various signaling pathways. 14-3-3 sigma is also called stratifin or HME1 and appears to function as a tumor suppressor whose expression can be downregulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis. Alternate names for 14-3-3 sigma include epithelial marker protein 1, SFN and YWHAS.

Alternate Names

1433 sigma, Epithelial cell marker protein 1, SFN, YWHAS

Gene Symbol

SFN

Additional 14-3-3 sigma Products

Product Documents for 14-3-3 sigma/Stratifin Antibody (8C8A9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 14-3-3 sigma/Stratifin Antibody (8C8A9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 sigma/Stratifin Antibody (8C8A9)

There are currently no reviews for this product. Be the first to review 14-3-3 sigma/Stratifin Antibody (8C8A9) and earn rewards!

Have you used 14-3-3 sigma/Stratifin Antibody (8C8A9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies