4-1BB Ligand/TNFSF9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56103

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 4-1BB Ligand/TNFSF9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit 4-1BB Ligand/TNFSF9 Antibody - BSA Free (NBP2-56103) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for 4-1BB Ligand/TNFSF9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 4-1BB Ligand/TNFSF9 Antibody [NBP2-56103]

Immunocytochemistry/ Immunofluorescence: 4-1BB Ligand/TNFSF9 Antibody [NBP2-56103]

Immunocytochemistry/Immunofluorescence: 4-1BB Ligand/TNFSF9 Antibody [NBP2-56103] - Staining of human cell line SiHa shows localization to the Golgi apparatus.

Applications for 4-1BB Ligand/TNFSF9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 4-1BB Ligand/TNFSF9

CD137 exists on the cell surface as a monomer with a molecular mass of 30 kDa and as a dimer of 55 kDa. Human and mouse CD137 share 60% amino acid identity. CD137 (4-1BB), a member of the tumor necrosis factor receptor superfamily, is a type I transmembrane glycoprotein expressed on the cell surface of activated splenic T cells and thymocytes. The functions of CD137 in T lymphocytes include regulating activation, proliferation and apoptosis. CD137 and CD28 are costimulatory molecules of T cell activation. Costimulatory molecules are important in initiating anti-tumor immune responses. CD137 plays an important role in regulating T-cell-dependent immune responses. Expression of CD137 correlates negatively with lymphocyte proliferation and positively with the degree of activation-induced cell death caused by mitogen over stimulation. In monocytes, CD137 induces activation, promotes adherence and prolongs survival.

Alternate Names

41BB Ligand, CD137L, TNFSF9

Gene Symbol

TNFSF9

Additional 4-1BB Ligand/TNFSF9 Products

Product Documents for 4-1BB Ligand/TNFSF9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 4-1BB Ligand/TNFSF9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 4-1BB Ligand/TNFSF9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 4-1BB Ligand/TNFSF9 Antibody - BSA Free and earn rewards!

Have you used 4-1BB Ligand/TNFSF9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies