4-1BB/TNFRSF9/CD137 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56432

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 4-1BB/TNFRSF9/CD137 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit 4-1BB/TNFRSF9/CD137 Antibody - BSA Free (NBP2-56432) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for 4-1BB/TNFRSF9/CD137 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 4-1BB/TNFRSF9/CD137 Antibody [NBP2-56432]

Immunocytochemistry/ Immunofluorescence: 4-1BB/TNFRSF9/CD137 Antibody [NBP2-56432]

Immunocytochemistry/Immunofluorescence: 4-1BB/TNFRSF9/CD137 Antibody [NBP2-56432] - Staining of human cell line U-2 OS shows localization to nucleoli & plasma membrane.

Applications for 4-1BB/TNFRSF9/CD137 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 4-1BB/TNFRSF9/CD137

4-1BB, also called CD137 and tumor necrosis factor receptor superfamily member 9 (TNFRSF9), is a type I surface glycoprotein expressed on activated T cell and natural killer (NK) cells (1,2). Human 4-1BB protein is 255 amino acids (aa) in length with a theoretical molecular weight of 28 kDa. It contains an extracellular domain, a helical transmembrane domain, and a cytoplasmic/intracellular domain (3). 4-1BB/TNFRSF9/CD137 is a costimulatory receptor that binds the ligand 4-1BBL/CD137L which is primarily expressed on antigen presenting cells (APCs) such as dendritic cells (DCs), macrophages, and B cells (1,2,4,5). The 4-1BB receptor-ligand interaction results in recruitment of TNFR-associated factor (TRAF) family adaptor proteins to 4-1BB's cytoplasmic domain (1,2,4,5). TRAF1, TRAF2, and TRAF3 are found in various homodimer and/or heterodimer configurations. Their recruitment to 4-1BB/CD137 initiates signalosome formation as well as activation of the nuclear factor-kappa B (NF-kappaB) and mitogen-activated protein kinase (MAPK) signaling cascade (1,4,5). 4-1BB/TNFRSF9/CD137 stimulation leads to increased cellular cytotoxic activity and pro-inflammatory cytokine production (1,2,4). Given its role in immune cell activation, 4-1BB has become a promising target for cancer immunotherapy (1,2,4). Current approaches to target 4-1BB include agonistic monoclonal and bispecific anti-4-1BB antibodies and well as utilizing the cytoplasmic domain of 4-1BB in generating chimeric antigen receptors (CARs) (1,2,4). 4-1BB agonists in clinical trials include Urelumab and Utolimumab. Utolimumab also has ligand blocking properties whereas Urelumab does not (1,2,4). Anti-4-1BB monoclonal antibodies are being tested as monotherapy as well as combination therapy with either other immunostimulatory monoclonal antibodies or with checkpoint blockade antibodies like anti-PD-1 (1,2,4).

References

1. Etxeberria, I., Glez-Vaz, J., Teijeira, A., & Melero, I. (2020). New emerging targets in cancer immunotherapy: CD137/4-1BB costimulatory axis. ESMO open, 4(Suppl 3), e000733. https://doi.org/10.1136/esmoopen-2020-000733

2. Chester, C., Sanmamed, M. F., Wang, J., & Melero, I. (2018). Immunotherapy targeting 4-1BB: mechanistic rationale, clinical results, and future strategies. Blood, 131(1), 49-57. https://doi.org/10.1182/blood-2017-06-741041

3. Uniport (Q07011)

4. Chester, C., Ambulkar, S., & Kohrt, H. E. (2016). 4-1BB agonism: adding the accelerator to cancer immunotherapy. Cancer Immunology, Immunotherapy: CII, 65(10), 1243-1248. https://doi.org/10.1007/s00262-016-1829-2

5. Zapata, J. M., Perez-Chacon, G., Carr-Baena, P., Martinez-Forero, I., Azpilikueta, A., Otano, I., & Melero, I. (2018). CD137 (4-1BB) signalosome: complexity is a matter of TRAFs. Frontiers in Immunology, 9, 2618. https://doi.org/10.3389/fimmu.2018.02618

Alternate Names

41BB, CD137, ILA, TNFRSF9

Gene Symbol

TNFRSF9

Additional 4-1BB/TNFRSF9/CD137 Products

Product Documents for 4-1BB/TNFRSF9/CD137 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 4-1BB/TNFRSF9/CD137 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 4-1BB/TNFRSF9/CD137 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 4-1BB/TNFRSF9/CD137 Antibody - BSA Free and earn rewards!

Have you used 4-1BB/TNFRSF9/CD137 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies