4EBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89368

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 4EBP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 4EBP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368] - Staining of human salivary gland shows strong cytoplasmic positivity in cells in serous acini.
Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368]

Immunohistochemistry-Paraffin: 4EBP1 Antibody [NBP1-89368] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
4EBP1 Antibody - BSA Free Western Blot: 4EBP1 Antibody - BSA Free [NBP1-89368]

Western Blot: 4EBP1 Antibody - BSA Free [NBP1-89368]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
4EBP1 Antibody - BSA Free Western Blot: 4EBP1 Antibody - BSA Free [NBP1-89368]

Western Blot: 4EBP1 Antibody - BSA Free [NBP1-89368]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for 4EBP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 4EBP1

4E-BP1 (eIF4E-binding protein) also known as PHAS, is a 10-12 kDa acidic protein that compete with eIF4G for binding of eiF4E to the mRNA 5' cap structure (1). Binding of the 4E-BPs to eIF4E is reversible and is dependent on the phosphorylation status of 4E-BP. Non-phosphorylated 4E-BP1 will bind strongly to eiF4E while, the phosphorylated form will no (2)t. Akt, TOR, MAP kinase, S6 kinase, and Cdc2 are known kinases capable of inactivating 4E-BP1 binding to eIF4E by phosphorylating either threonines 35, 45, 69 or serine 64. Although, not all phosphorylation events equally block the 4EBP1-eIF4E interaction (3-4)

Long Name

Eukaryotic Translation Initiation Factor 4E Binding Protein 1

Alternate Names

EIF4EBP1, PHAS-I

Gene Symbol

EIF4EBP1

Additional 4EBP1 Products

Product Documents for 4EBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 4EBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons

Customer Reviews for 4EBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 4EBP1 Antibody - BSA Free and earn rewards!

Have you used 4EBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies