5-HT3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10358

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all 5-HT3B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human 5-HT3B (NP_006019). Peptide sequence PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for 5-HT3B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 5-HT3B Antibody [NBP3-10358]

Immunocytochemistry/ Immunofluorescence: 5-HT3B Antibody [NBP3-10358]

Immunocytochemistry/Immunofluorescence: 5-HT3B Antibody [NBP3-10358] - Immunofluorescence of mouse spinal cord, ventral horns.

Applications for 5-HT3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT3B

The product of the HT3B belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. (provided by RefSeq)

Long Name

5-Hydroxytryptamine Receptor 3B

Alternate Names

5HT3B, HTR3B

Gene Symbol

HTR3B

Additional 5-HT3B Products

Product Documents for 5-HT3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 5-HT3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 5-HT3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 5-HT3B Antibody - BSA Free and earn rewards!

Have you used 5-HT3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies