5'-Nucleotidase/CD73 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85740

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Porcine

Cited:

Human, Porcine, Primate - Macaca mulatta (Rhesus Macaque)

Predicted:

Mouse (90%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Frozen, Western Blot, ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all 5'-Nucleotidase/CD73 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK

Reactivity Notes

Porcine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 5'-Nucleotidase/CD73 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunocytochemistry/ Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for human aortic valve endothelial cells. Image from a verified customer review.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human liver shows strong membranous positivity in hepatocytes.
Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human aortic valve staining for CD73. Image from verified customer review.
Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for pig aortic valve. Image from verified customer review.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.
5'-Nucleotidase/CD73 Antibody - BSA Free Western Blot: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Western Blot: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Analysis in human cell line U-87 MG.
5'-Nucleotidase/CD73 Antibody - BSA Free Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Staining of human placenta shows very strong positivity in apical membrane in trophoblastic cells.
5'-Nucleotidase/CD73 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Immunocytochemistry/ Immunofluorescence: 5'-Nucleotidase/CD73 Antibody - BSA Free [NBP1-85740]

Staining of human cell line LHCN-M2 shows localization to nucleoplasm, plasma membrane & cytosol.

Applications for 5'-Nucleotidase/CD73 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 4 reviews rated 4.5 using NBP1-85740 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5'-Nucleotidase/CD73

Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM]

Alternate Names

5-NT, CD73, E5NT, eNT, NT5E, NTE

Entrez Gene IDs

4907 (Human)

Gene Symbol

NT5E

UniProt

P21589

Additional 5'-Nucleotidase/CD73 Products

Product Documents for 5'-Nucleotidase/CD73 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 5'-Nucleotidase/CD73 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for 5'-Nucleotidase/CD73 Antibody - BSA Free

Customer Reviews for 5'-Nucleotidase/CD73 Antibody - BSA Free (4)

4.5 out of 5
4 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used 5'-Nucleotidase/CD73 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 4 of 4 reviews Showing All
Filter By:
Clear Filters X
  • Name: Ewa Kaniewska
    Application: Western Blot
    Sample Tested:
    Species: Human
    Verified Customer | Posted 05/13/2014
    5'-Nucleotidase/CD73 Antibody - BSA Free NBP1-85740
  • Name: Ewa Kaniewska
    Application: Immunofluorescence
    Sample Tested:
    Species: Human
    Verified Customer | Posted 04/13/2014
    CD73 staining for human aortic valve endothelial cells.
    5'-Nucleotidase/CD73 Antibody - BSA Free NBP1-85740
  • Name: Ewa Kaniewska
    Application: Immunocytochemistry
    Sample Tested:
    Species: Other
    Verified Customer | Posted 03/27/2014
    CD73 staining for pig aortic valve.
    5'-Nucleotidase/CD73 Antibody - BSA Free NBP1-85740
  • Name: Ewa Kaniewska
    Application: Immunohistochemistry-Paraffin
    Sample Tested:
    Species: Human
    Verified Customer | Posted 03/27/2014
    Human aortic valve staining for CD73
    5'-Nucleotidase/CD73 Antibody - BSA Free NBP1-85740

There are no reviews that match your criteria.

Showing  1 - 4 of 4 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5'-Nucleotidase/CD73 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.

    A:

    We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies