ACAA1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86128
![Western Blot: ACAA1 Antibody [NBP1-86128]](https://resources.rndsystems.com/images/products/ACAA1-Antibody-Western-Blot-NBP1-86128-img0008.jpg "Western Blot: ACAA1 Antibody [NBP1-86128]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA
Marker
Peroxisome Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit ACAA1 Antibody - BSA Free (NBP1-86128) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for ACAA1 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: ACAA1 Antibody [NBP1-86128]](https://resources.rndsystems.com/images/products/ACAA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86128-img0006.jpg "Immunocytochemistry/ Immunofluorescence: ACAA1 Antibody [NBP1-86128]")
Immunocytochemistry/ Immunofluorescence: ACAA1 Antibody [NBP1-86128]
Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-86128] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.![ACAA1 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-23420251592581.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]")
![ACAA1 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-23420251573924.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]")
Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]
Staining of human skin shows very weak positivity in squamous epithelial cells.![ACAA1 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-23420251561929.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]")
Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]
Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.![ACAA1 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-23420251592527.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]")
Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]
Staining of human kidney shows strong granular cytoplasmic positivity in proximal tubules.![ACAA1 Antibody - BSA Free Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-24420259321513.jpg "Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]")
Immunohistochemistry-Paraffin: ACAA1 Antibody - BSA Free [NBP1-86128]
Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.![ACAA1 Antibody - BSA Free Western Blot: ACAA1 Antibody - BSA Free [NBP1-86128]](https://resources.rndsystems.com/images/products/nbp1-86128_rabbit-polyclonal-acaa1-antibody-24420259402410.jpg "Western Blot: ACAA1 Antibody - BSA Free [NBP1-86128]")
Western Blot: ACAA1 Antibody - BSA Free [NBP1-86128]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)
Applications for ACAA1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20-1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ACAA1
Alternate Names
Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal
Gene Symbol
ACAA1
Additional ACAA1 Products
Product Documents for ACAA1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ACAA1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ACAA1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ACAA1 Antibody - BSA Free and earn rewards!
Have you used ACAA1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...