ACAD10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49511

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACAD10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAD10 Antibody - BSA Free

Western Blot: ACAD10 Antibody [NBP2-49511]

Western Blot: ACAD10 Antibody [NBP2-49511]

Western Blot: ACAD10 Antibody [NBP2-49511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
ACAD10 Antibody

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] -

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human lymph node shows strong granular cytoplasmic positivity in non-germinal center cells.
ACAD10 Antibody

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] -

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human kidney shows moderate positivity in cytoplasm granular in cells in tubules.
ACAD10 Antibody

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] -

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human placenta shows strong positivity in cytoplasm granular in trophoblastic cells.
ACAD10 Antibody

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] -

Immunohistochemistry-Paraffin: ACAD10 Antibody [NBP2-49511] - Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

Applications for ACAD10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAD10

ACAD10 encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Alternate Names

ACAD-10, acyl-CoA dehydrogenase family member 10, acyl-CoA dehydrogenase family, member 10, acyl-Coenzyme A dehydrogenase family, member 10, EC 1.3.99.-, MGC5601

Gene Symbol

ACAD10

Additional ACAD10 Products

Product Documents for ACAD10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACAD10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ACAD10 Antibody - BSA Free

Customer Reviews for ACAD10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACAD10 Antibody - BSA Free and earn rewards!

Have you used ACAD10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies