ACAD9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56718

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACAD9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLA

Reactivity Notes

Mouse 87%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ACAD9 Antibody - BSA Free (NBP2-56718) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ACAD9 Antibody - BSA Free

Western Blot: ACAD9 Antibody [NBP2-56718]

Western Blot: ACAD9 Antibody [NBP2-56718]

Western Blot: ACAD9 Antibody [NBP2-56718] - Analysis using Anti-ACAD9 antibody NBP2-56718 (A) shows similar pattern to independent antibody NBP1-82749 (B).
Immunocytochemistry/ Immunofluorescence: ACAD9 Antibody [NBP2-56718]

Immunocytochemistry/ Immunofluorescence: ACAD9 Antibody [NBP2-56718]

Immunocytochemistry/Immunofluorescence: ACAD9 Antibody [NBP2-56718] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Applications for ACAD9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAD9

Mitochondrial fatty acid beta-oxidation is one of the main energy-producing metabolic pathways in eukaryotes. Acyl-CoA dehydrogenases (ACADs; EC 1.3.99.13) are mitochondrial enzymes that catalyze the initial rate-limiting step in the beta-oxidation of fatty acyl-CoA. ACAD9 belongs to a group of ACADs that act on fatty acids containing 14 to 20 carbons (Zhang et al., 2002 [PubMed 12359260]).[supplied by OMIM]

Alternate Names

ACAD-9, acyl-CoA dehydrogenase family member 9, mitochondrial, acyl-CoA dehydrogenase family, member 9, acyl-Coenzyme A dehydrogenase family, member 9, EC 1.3.99, EC 1.3.99.-, EC 1.3.99.10, FLJ23533, MGC14452, NPD002

Gene Symbol

ACAD9

Additional ACAD9 Products

Product Documents for ACAD9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACAD9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACAD9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACAD9 Antibody - BSA Free and earn rewards!

Have you used ACAD9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies