Acetyl-coenzyme A transporter 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59882

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC33A1(solute carrier family 33 (acetyl-CoA transporter), member 1) The peptide sequence was selected from the middle region of SLC33A1. Peptide sequence CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Antibody Titration: 1 ug/ml Human heart.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882]

Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Applications for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Acetyl-coenzyme A transporter 1

SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Alternate Names

ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant)

Gene Symbol

SLC33A1

UniProt

Additional Acetyl-coenzyme A transporter 1 Products

Product Documents for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Acetyl-coenzyme A transporter 1 Antibody - BSA Free and earn rewards!

Have you used Acetyl-coenzyme A transporter 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...