Acidic Calponin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37886

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 220-329 of human Acidic Calponin (NP_001830.1).

Sequence:
LAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Acidic Calponin Antibody - BSA Free (NBP3-37886) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Acidic Calponin Antibody - BSA Free

Acidic Calponin Antibody

Western Blot: Acidic Calponin Antibody [NBP3-37886] -

Western Blot: Acidic Calponin Antibody [NBP3-37886] - Western blot analysis of various lysates using Acidic Calponin Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Acidic Calponin Antibody

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] -

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] - Immunofluorescence analysis of NIH/3T3 cells using Acidic Calponin Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Acidic Calponin Antibody

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] -

Immunocytochemistry/ Immunofluorescence: Acidic Calponin Antibody [NBP3-37886] - Immunofluorescence analysis of U2OS cells using Acidic Calponin Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Acidic Calponin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Acidic Calponin

Acidic Calponin, or CNN3 for short, consists of a 329 amino acid isoform that is 36 kDa, and is involved in the regulation of smooth muscle contraction. Current research is being conducted on the relationship between acidic calponin and several diseases and disorders, including aortic aneurysm and neuronitis. The protein is not associated with any pathways, but it does interact with the proteins FYN, SLX4, ATG5, LCP1, and EMD.

Alternate Names

calponin 3, acidic, Calponin, acidic isoform, calponin-3, dJ639P13.2.2 (acidic calponin 3)

Gene Symbol

CNN3

Additional Acidic Calponin Products

Product Documents for Acidic Calponin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acidic Calponin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acidic Calponin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Acidic Calponin Antibody - BSA Free and earn rewards!

Have you used Acidic Calponin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...