ACOT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54709

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACOT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOT1 Antibody - BSA Free

Western Blot: ACOT1 Antibody [NBP2-54709]

Western Blot: ACOT1 Antibody [NBP2-54709]

Western Blot: ACOT1 Antibody [NBP2-54709] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue
Immunocytochemistry/ Immunofluorescence: ACOT1 Antibody [NBP2-54709]

Immunocytochemistry/ Immunofluorescence: ACOT1 Antibody [NBP2-54709]

Immunocytochemistry/Immunofluorescence: ACOT1 Antibody [NBP2-54709] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709]

Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709]

Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for ACOT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT1

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fattyacid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acidsand CoASH. Active towards fatty acyl-CoA with chain-lengths of C12-C16

Alternate Names

ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase

Gene Symbol

ACOT1

Additional ACOT1 Products

Product Documents for ACOT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACOT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACOT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACOT1 Antibody - BSA Free and earn rewards!

Have you used ACOT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies