ACOX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57292

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOX2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining in human liver and lymph node tissues using anti-ACOX2 antibody. Corresponding ACOX2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon, liver, lymph node and testis using Anti-ACOX2 antibody NBP2-57292 (A) shows similar protein distribution across tissues to independent antibody NBP1-88364 (B).
Western Blot: ACOX2 Antibody [NBP2-57292]

Western Blot: ACOX2 Antibody [NBP2-57292]

Western Blot: ACOX2 Antibody [NBP2-57292] - Western blot analysis in control (vector only transfected HEK293T lysate) and ACOX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: ACOX2 Antibody [NBP2-57292]

Immunocytochemistry/ Immunofluorescence: ACOX2 Antibody [NBP2-57292]

Immunocytochemistry/Immunofluorescence: ACOX2 Antibody [NBP2-57292] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human testis.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292]

Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon.

Applications for ACOX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOX2

The product of this gene belongs to the acyl-CoA oxidases family. It encodes the branched-chain acyl-CoA oxidase which is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. Deficiency of this enzyme results in the accumulation of branched fatty acids and bile acid intermediates, and may lead to Zellweger syndrome, severe mental retardation and death in children. [provided by RefSeq]

Alternate Names

12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase, 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase, 3-alpha, 7-alpha, acyl-CoA oxidase 2, branched chain, acyl-Coenzyme A oxidase 2, branched chain, BCOX, BRCACOXTHCA-CoA oxidase, BRCOX, EC 1.17.99.3, peroxisomal acyl-coenzyme A oxidase 2,3-alpha, peroxisomal branched chain acyl-CoA oxidase, THCCox, Trihydroxycoprostanoyl-CoA oxidase

Gene Symbol

ACOX2

Additional ACOX2 Products

Product Documents for ACOX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACOX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACOX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACOX2 Antibody - BSA Free and earn rewards!

Have you used ACOX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...