ACSL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACSL1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACSL1 (acyl-CoA synthetase long-chain family member 1) The peptide sequence was selected from the C terminal of ACSL1. Peptide sequence GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACSL1 Antibody - BSA Free

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016] - Human Hela
Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - Human kidney, renal corpuscle cells are marked by arrows. Reccomended concentration is 4 - 8 ug/ml.
Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016] - Hum. Fetal Brain.
Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016] - Human Hela.
Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016]

Western Blot: ACSL1 Antibody [NBP1-60016] - Human 721_B cells ACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-60016] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016]

Immunohistochemistry: ACSL1 Antibody [NBP1-60016] - heart, liver, pancreas, brain

Applications for ACSL1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSL1

ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1

Gene Symbol

ACSL1

UniProt

P33121 (Human)

Additional ACSL1 Products

Product Documents for ACSL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACSL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ACSL1 Antibody - BSA Free

Customer Reviews for ACSL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACSL1 Antibody - BSA Free and earn rewards!

Have you used ACSL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies