ACSL5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59645
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for ACSL5 Antibody - BSA Free
Western Blot: ACSL5 Antibody [NBP1-59645]
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645]
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.Western Blot: ACSL5 Antibody [NBP1-59645]
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.Simple Western: ACSL5 Antibody [NBP1-59645]
Simple Western: ACSL5 Antibody [NBP1-59645] - Simple Western analysis of mouse liver lysate. Simple Western image submitted by a verified customer review.Applications for ACSL5 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10 - 1:500
Immunohistochemistry-Paraffin
4 - 8 ug/mL
Western Blot
1.0 ug/ml
Application Notes
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse liver lysate, separated by Size
Reviewed Applications
Read 2 reviews rated 4.5 using NBP1-59645 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ACSL5
Alternate Names
ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5
Gene Symbol
ACSL5
UniProt
Additional ACSL5 Products
Product Documents for ACSL5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ACSL5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ACSL5 Antibody - BSA Free
Customer Reviews for ACSL5 Antibody - BSA Free (2)
4.5 out of 5
2 Customer Ratings
Have you used ACSL5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Simple WesternSample Tested: mouse liver lysateSpecies: MouseVerified Customer | Posted 07/01/2020Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
-
Application: Western BlotSample Tested:Species: RatVerified Customer | Posted 09/04/2013Western blot of INS832/13 cells after KD of Acsl5
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...