ADAM15 Antibody (4T4X10)

Novus Biologicals | Catalog # NBP3-16642

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4T4X10 expressed in HEK293
View all ADAM15 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444). RHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ADAM15 Antibody (4T4X10) (NBP3-16642) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADAM15 Antibody (4T4X10)

Western Blot: ADAM15 Antibody (4T4X10) [NBP3-16642]

Western Blot: ADAM15 Antibody (4T4X10) [NBP3-16642]

Western Blot: ADAM15 Antibody (4T4X10) [NBP3-16642] - Western blot analysis of extracts of HCT116 cells, using ADAM15 Rabbit mAb (NBP3-16642) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
ADAM15 Antibody (4T4X10)

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ADAM15 Antibody (4T4X10)

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Confocal imaging of paraffin-embedded mouse large intestine using ADAM15 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
ADAM15 Antibody (4T4X10)

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ADAM15 Antibody (4T4X10)

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ADAM15 Antibody (4T4X10)

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ADAM15 Antibody (4T4X10)

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunohistochemistry: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ADAM15 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ADAM15 Antibody (4T4X10)

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Immunofluorescence analysis of paraffin-embedded rat rectum using ADAM15 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ADAM15 Antibody (4T4X10)

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] -

Immunocytochemistry/ Immunofluorescence: ADAM15 Antibody (4T4X10) [NBP3-16642] - Confocal imaging of paraffin-embedded Human colon cancer using ADAM15 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Applications for ADAM15 Antibody (4T4X10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ADAM15

ADAM15 is encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Long Name

A Disintegrin and Metalloprotease-like Domain 15

Alternate Names

MDC15, Metargidin

Gene Symbol

ADAM15

Additional ADAM15 Products

Product Documents for ADAM15 Antibody (4T4X10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAM15 Antibody (4T4X10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAM15 Antibody (4T4X10)

There are currently no reviews for this product. Be the first to review ADAM15 Antibody (4T4X10) and earn rewards!

Have you used ADAM15 Antibody (4T4X10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies