ADE2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38269

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADE2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 176-425 of human ADE2 (NP_001072992.1).

Sequence:
LEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit ADE2 Antibody - BSA Free (NBP3-38269) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADE2 Antibody - BSA Free

ADE2 Antibody

Western Blot: ADE2 Antibody [NBP3-38269] -

Western Blot: ADE2 Antibody [NBP3-38269] - Western blot analysis of various lysates using ADE2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
ADE2 Antibody

Immunocytochemistry/ Immunofluorescence: ADE2 Antibody [NBP3-38269] -

Immunocytochemistry/ Immunofluorescence: ADE2 Antibody [NBP3-38269] - Immunofluorescence analysis of U2OS cells using ADE2 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ADE2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ADE2

The ADE2 gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine bio

Alternate Names

ADE2, AIR carboxylase, AIRCADE2H1, DKFZp781N1372, MGC1343, MGC5024, multifunctional protein ADE2, PAIS, phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase, SAICAR synthetase

Gene Symbol

PAICS

Additional ADE2 Products

Product Documents for ADE2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADE2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADE2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADE2 Antibody - BSA Free and earn rewards!

Have you used ADE2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies