ADK Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90197

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ADK Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ADK Antibody [NBP1-90197]

Immunocytochemistry/ Immunofluorescence: ADK Antibody [NBP1-90197]

Immunocytochemistry/Immunofluorescence: ADK Antibody [NBP1-90197] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ADK Antibody [NBP1-90197]

Immunohistochemistry-Paraffin: ADK Antibody [NBP1-90197]

Immunohistochemistry-Paraffin: ADK Antibody [NBP1-90197] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Western Blot: ADK Antibody [NBP1-90197]

Western Blot: ADK Antibody [NBP1-90197]

Western Blot: ADK Antibody [NBP1-90197] - Analysis in human cell lines PC-3 and A-549 using anti-ADK antibody. Corresponding ADK RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
ADK Antibody - BSA Free Western Blot: ADK Antibody - BSA Free [NBP1-90197]

Western Blot: ADK Antibody - BSA Free [NBP1-90197]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for ADK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADK

Adenosine kinase (ATP:adenosine 5 prime phosphotransferase) is an abundant enzyme in mammalian tissues that catalyzes the transfer of the gamma phosphate from ATP to adenosine, thereby serving as a potentially important regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of ADK could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as antiinflammatory agents. The encoded protein does not present any sequence similarities to other well characterized mammalian nucleoside kinases. In contrast, 2 regions were identified with significant sequence identity to microbial ribokinase and fructokinases and a bacterial inosine/guanosine kinase. Thus, ADK is a structurally distinct mammalian nucleoside kinase that appears to be akin to sugar kinases of microbial origin.

Long Name

Adenosine Kinase

Alternate Names

AK

Gene Symbol

ADK

Additional ADK Products

Product Documents for ADK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADK Antibody - BSA Free and earn rewards!

Have you used ADK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies