Catalog Number: 4812
Biological Activity
Potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis.
Technical Data
  • M.Wt:
    4071.86
  • Formula:
    C169H281N57O46S7
  • Sequence:
    VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK

    (Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Structural basis of a potent peptide inhibitor designed for KV1.3 channel, a therapeutic target of autoimmune disease.
    Han et al.
    J.Biol.Chem., 2008;283:19058
  2. Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model.
    Li et al.
    J.Biol.Chem., 2012;287:29479

Have you used ADWX 1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information