ADWX 1
Discontinued Product
4812 has been discontinued.
View all Voltage-gated Potassium Channel Blockers products.
1 Image
Description: Potent and selective KV1.3 channel blocker
Biological Activity
ADWX 1 is a potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis.Technical Data
M.Wt:
4071.86
Formula:
C169H281N57O46S7
Sequence:
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK
(Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34)
Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Structural basis of a potent peptide inhibitor designed for KV1.3 channel, a therapeutic target of autoimmune disease.
Han et al.
J.Biol.Chem., 2008;283:19058 -
Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model.
Li et al.
J.Biol.Chem., 2012;287:29479
Product Datasheets
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for ADWX 1
There are currently no reviews for this product. Be the first to review ADWX 1 and earn rewards!
Have you used ADWX 1?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.
