ADWX 1

Catalog # Availability Size / Price Qty
4812/100U
Voltage-gated Potassium Channel Blockers Peptide
1 Image
Description: Potent and selective KV1.3 channel blocker
Product Details
Reviews (1)

Biological Activity

Potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis.

Technical Data

M.Wt:
4071.86
Formula:
C169H281N57O46S7
Sequence:
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK

(Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34)

Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ADWX 1

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used ADWX 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Product was used on KV1.1 channels on increasing concentrations
By Anonymous on 12/21/2018
Species: Human

Product was used on KV1.1 channels to measure the percentage blocking action exhibited against increasing concentration. Concentration action relation was studied on various cell lines expressing Kv 1.1 channels to understand the differences.


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.