Catalog Number: 5195
Biological Activity
Potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively).
Technical Data
  • M.Wt:
    4090.87
  • Formula:
    C169H278N54O48S8
  • Sequence:
    GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

    (Modifications: Disulfide bridge: 8-28,14-33,18-35)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    168147-41-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom.
    Garcia et al.
    Biochemistry, 1994;33:6834
  2. Recombinant expression of margatoxin and agitoxin-2 in Pichia pastoris: an efficient method for production of KV1.3 channel blockers.
    Anangi et al.
    PLoS ONE, 2012;7:e52965
  3. Agitoxin footprinting the shaker potassium channel pore.
    Gross et al.
    Neuron, 1996;16:399

Have you used Agitoxin 2?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information