Agitoxin 2
Discontinued Product
5195 has been discontinued.
View all Voltage-gated Potassium Channel Blockers products.
1 Image
Description: Potent Shaker K+ channel blocker
Biological Activity
Agitoxin 2 is a potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively).Technical Data
M.Wt:
4090.87
Formula:
C169H278N54O48S8
Sequence:
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK
(Modifications: Disulfide bridge: 8-28,14-33,18-35)
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
168147-41-9
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom.
Garcia et al.
Biochemistry, 1994;33:6834 -
Recombinant expression of margatoxin and agitoxin-2 in Pichia pastoris: an efficient method for production of KV1.3 channel blockers.
Anangi et al.
PLoS ONE, 2012;7:e52965 -
Agitoxin footprinting the shaker potassium channel pore.
Gross et al.
Neuron, 1996;16:399
Product Datasheets
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for Agitoxin 2
There are currently no reviews for this product. Be the first to review Agitoxin 2 and earn rewards!
Have you used Agitoxin 2?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.
