AGTRAP Antibody (1G2) - Azide and BSA Free

Novus Biologicals | Catalog # H00057085-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1G2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

AGTRAP (NP_065083, 108 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS

Reactivity Notes

Human. Other species not tested.

Specificity

AGTRAP - angiotensin II receptor-associated protein

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for AGTRAP Antibody (1G2) - Azide and BSA Free

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - AGTRAP monoclonal antibody (M02), clone 1G2 Analysis of AGTRAP expression in Hela S3 NE.
Immunohistochemistry-Paraffin: AGTRAP Antibody (1G2) [H00057085-M02]

Immunohistochemistry-Paraffin: AGTRAP Antibody (1G2) [H00057085-M02]

Immunohistochemistry-Paraffin: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. Antibody concentration 0.8 ug/ml.
Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of AGTRAP over-expressed 293 cell line, cotransfected with AGTRAP Validated Chimera RNAi ( Cat # H00057085-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AGTRAP monoclonal antibody (M02), clone 1G2 (Cat # H00057085-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02]

Western Blot: AGTRAP Antibody (1G2) [H00057085-M02] - Analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody (M02), clone 1G2.Lane 1: AGTRAP transfected lysate(16.7 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: AGTRAP Antibody (1G2) [H00057085-M02] - Detection limit for recombinant GST tagged AGTRAP is approximately 0.1ng/ml as a capture antibody.

Applications for AGTRAP Antibody (1G2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AGTRAP

This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

Alternate Names

angiotensin II receptor-associated protein, AT1 receptor-associated protein, ATI receptor-associated protein, MGC29646, type I receptor-associated protein, type-1 angiotensin II receptor-associated protein

Entrez Gene IDs

57085 (Human)

Gene Symbol

AGTRAP

OMIM

608729 (Human)

Additional AGTRAP Products

Product Documents for AGTRAP Antibody (1G2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AGTRAP Antibody (1G2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AGTRAP Antibody (1G2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review AGTRAP Antibody (1G2) - Azide and BSA Free and earn rewards!

Have you used AGTRAP Antibody (1G2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...