Aiolos/IKZF3 Antibody (4U7F9)

Novus Biologicals | Catalog # NBP3-16668

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4U7F9 expressed in HEK293
View all Aiolos/IKZF3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human Aiolos/IKZF3 (Q9UKT9). IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Aiolos/IKZF3 Antibody (4U7F9) (NBP3-16668) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Aiolos/IKZF3 Antibody (4U7F9)

Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4V2Z2) [NBP3-16668] - Western blot analysis of extracts of various cell lines, using Aiolos/IKZF3 antibody (NBP3-16668) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4V2Z2) [NBP3-16668] - Western blot analysis of extracts of Raji cells, using Aiolos/IKZF3 antibody (NBP3-16668) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668]

Western Blot: Aiolos/IKZF3 Antibody (4V2Z2) [NBP3-16668] - Western blot analysis of extracts of Rat lung, using Aiolos/IKZF3 antibody (NBP3-16668) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Aiolos/IKZF3 Antibody (4U7F9)

Immunoprecipitation: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] -

Immunoprecipitation: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] - Immunoprecipitation analysis of 300 ug extracts of Raji cells using 3 ug Aiolos/IKZF3 antibody. Western blot was performed from the immunoprecipitate using Aiolos/IKZF3 antibody at a dilution of 1:500.
Aiolos/IKZF3 Antibody (4U7F9)

Immunocytochemistry/ Immunofluorescence: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] -

Immunocytochemistry/ Immunofluorescence: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] - Immunofluorescence analysis of paraffin-embedded rat spleen using Aiolos/IKZF3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Aiolos/IKZF3 Antibody (4U7F9)

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] -

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Aiolos/IKZF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Aiolos/IKZF3 Antibody (4U7F9)

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] -

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Aiolos/IKZF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Aiolos/IKZF3 Antibody (4U7F9)

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] -

Immunohistochemistry: Aiolos/IKZF3 Antibody (4U7F9) [NBP3-16668] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Aiolos/IKZF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Aiolos/IKZF3 Antibody (4U7F9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aiolos/IKZF3

IKZF3 encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Long Name

DNA-binding Protein Aiolos

Alternate Names

AIO, IKZF3, ZNFN1A3

Gene Symbol

IKZF3

Additional Aiolos/IKZF3 Products

Product Documents for Aiolos/IKZF3 Antibody (4U7F9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aiolos/IKZF3 Antibody (4U7F9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aiolos/IKZF3 Antibody (4U7F9)

There are currently no reviews for this product. Be the first to review Aiolos/IKZF3 Antibody (4U7F9) and earn rewards!

Have you used Aiolos/IKZF3 Antibody (4U7F9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies