AKR1B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56910

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AKR1B1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY

Reactivity Notes

Mouse 83%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AKR1B1 Antibody - BSA Free

Western Blot: AKR1B1 Antibody [NBP2-56910]

Western Blot: AKR1B1 Antibody [NBP2-56910]

Western Blot: AKR1B1 Antibody [NBP2-56910] - Western blot analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP2-56910] - Staining of human cerebral cortex shows low expression as expected.

Applications for AKR1B1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKR1B1

Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.

Alternate Names

ADR, Aldehyde reductase, Aldo-keto reductase family 1 member B1, aldo-keto reductase family 1, member B1 (aldose reductase), ALDR1aldose reductase, ALR2, ARaldehyde reductase 1, EC 1.1.1, EC 1.1.1.21, Lii5-2 CTCL tumor antigen, low Km aldose reductase, MGC1804

Gene Symbol

AKR1B1

Additional AKR1B1 Products

Product Documents for AKR1B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AKR1B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKR1B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKR1B1 Antibody - BSA Free and earn rewards!

Have you used AKR1B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies