alcohol dehydrogenase 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10572

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all alcohol dehydrogenase 4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human alcohol dehydrogenase 4 (NP_000661). Peptide sequence PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alcohol dehydrogenase 4 Antibody - BSA Free

Immunohistochemistry: alcohol dehydrogenase 4 Antibody [NBP3-10572]

Immunohistochemistry: alcohol dehydrogenase 4 Antibody [NBP3-10572]

Immunohistochemistry: alcohol dehydrogenase 4 Antibody [NBP3-10572] - Immunohistochemical analysis of fetal liver cell lysate tissue at an antibody concentration of 1.25 ug/ml.

Applications for alcohol dehydrogenase 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 4

alcohol dehydrogenase 4 encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

Alternate Names

ADH-2, alcohol dehydrogenase 4, alcohol dehydrogenase 4 (class II), pi polypeptide, Alcohol dehydrogenase class II pi chain, aldehyde reductase, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH4

Additional alcohol dehydrogenase 4 Products

Product Documents for alcohol dehydrogenase 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alcohol dehydrogenase 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alcohol dehydrogenase 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase 4 Antibody - BSA Free and earn rewards!

Have you used alcohol dehydrogenase 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies