alcohol dehydrogenase 6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62658

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alcohol dehydrogenase 6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit alcohol dehydrogenase 6 Antibody - BSA Free (NBP2-62658) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for alcohol dehydrogenase 6 Antibody - BSA Free

Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis using Anti-ADH6 antibody NBP2-62658 (A) shows similar pattern to independent antibody NBP2-62661 (B).
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human testis.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon, kidney, liver and testis using Anti-ADH6 antibody NBP2-62658 (A) shows similar protein distribution across tissues to independent antibody NBP2-62661 (B).
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human kidney.

Applications for alcohol dehydrogenase 6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 6

alcohol dehydrogenase 6 encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5' UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ADH-5, alcohol dehydrogenase 6, alcohol dehydrogenase 6 (class V), aldehyde reductase, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH6

Additional alcohol dehydrogenase 6 Products

Product Documents for alcohol dehydrogenase 6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alcohol dehydrogenase 6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alcohol dehydrogenase 6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase 6 Antibody - BSA Free and earn rewards!

Have you used alcohol dehydrogenase 6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies