ALDH4A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38007

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ALDH4A1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 354-563 of human ALDH4A1 (NP_003739.2).

Sequence:
LYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALDH4A1 Antibody - BSA Free

ALDH4A1 Antibody

Western Blot: ALDH4A1 Antibody [NBP3-38007] -

Western Blot: ALDH4A1 Antibody [NBP3-38007] - Western blot analysis of various lysates, using ALDH4A1 Rabbit pAb at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
ALDH4A1 Antibody

Immunocytochemistry/ Immunofluorescence: ALDH4A1 Antibody [NBP3-38007] -

Immunocytochemistry/ Immunofluorescence: ALDH4A1 Antibody [NBP3-38007] - Immunofluorescence analysis of A549 cells using ALDH4A1 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

Applications for ALDH4A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:2000 - 1:7000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ALDH4A1

ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Two transcript variants encoding the same protein have been identified for this gene.

Alternate Names

aldehyde dehydrogenase 4 family, member A1, Aldehyde dehydrogenase family 4 member A1, ALDH4DKFZp779M035, delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial, EC 1.5.1.12, mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase, P5C dehydrogenase, P5CD, P5CDH

Gene Symbol

ALDH4A1

Additional ALDH4A1 Products

Product Documents for ALDH4A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALDH4A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALDH4A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALDH4A1 Antibody - BSA Free and earn rewards!

Have you used ALDH4A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies