Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68877

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877]

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877]

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Immunohistochemistry: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877]

Immunohistochemistry: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877]

Immunohistochemistry: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68877] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldo-keto Reductase 1C1/AKR1C1

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Long Name

Aldo-keto Reductase Family 1, Member C1

Alternate Names

2-ALPHA-HSD, 20-ALPHA-HSD, AKR1C1, AldoketoReductase 1C1, DDH1, HAKRC, HBAB

Entrez Gene IDs

1645 (Human)

Gene Symbol

AKR1C1

UniProt

Additional Aldo-keto Reductase 1C1/AKR1C1 Products

Product Documents for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free and earn rewards!

Have you used Aldo-keto Reductase 1C1/AKR1C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...