ALK-1 Antibody (8L2V7)

Novus Biologicals | Catalog # NBP3-16876

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8L2V7 expressed in HEK293
View all ALK-1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 404-503 of human ALK-1 (P37023). VLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALK-1 Antibody (8L2V7)

Western Blot: ALK-1 Antibody (8L2V7) [NBP3-16876]

Western Blot: ALK-1 Antibody (8L2V7) [NBP3-16876]

Western Blot: ALK-1 Antibody (8L2V7) [NBP3-16876] - Analysis of extracts of various cell lines, using ALK-1 Rabbit mAb (NBP3-16876) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
ALK-1 Antibody (8L2V7)

Immunocytochemistry/Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -

Immunocytochemistry/Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -Confocal imaging of C6 cells using ACVRL1 Rabbit mAb (dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ALK-1 Antibody (8L2V7)

Immunocytochemistry/Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -

Immunocytochemistry/Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -Confocal imaging of NIH/3T3 cells using ACVRL1 Rabbit mAb (dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ALK-1 Antibody (8L2V7)

Immunocytochemistry/ Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -

Immunocytochemistry/ Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] - Confocal imaging of C6 cells using ALK-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ALK-1 Antibody (8L2V7)

Immunocytochemistry/ Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] -

Immunocytochemistry/ Immunofluorescence: ALK-1 Antibody (8L2V7) [NBP3-16876] - Confocal imaging of NIH/3T3 cells using ALK-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for ALK-1 Antibody (8L2V7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ALK-1

LTK, ALK and Ros have been identified as receptor tyrosine kinases having sequence similarity to the insulin receptor subfamily of kinases. LTK (leukocyte tyrosine kinase) is expressed in murine B lymphocyte precursors and has also been found in forebrain neurons. ALK (anaplastic lymphoma kinase) is normally highly expressed, specifically in the nervous system. A truncated form containing the catalytic domian of ALK is expressed as the result of a translocation occurring in many non-Hodgkin's lymphomas. The c-Ros gene was originally identified in mutant form as an oncogene. Ros is normally expressed in a small number of epithelial cell types and may play a role in epithelial development.

Long Name

Activin Receptor-like Kinase 1

Alternate Names

ACVRL1, ALK1

Gene Symbol

ACVRL1

Additional ALK-1 Products

Product Documents for ALK-1 Antibody (8L2V7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALK-1 Antibody (8L2V7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALK-1 Antibody (8L2V7)

There are currently no reviews for this product. Be the first to review ALK-1 Antibody (8L2V7) and earn rewards!

Have you used ALK-1 Antibody (8L2V7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

TGF-beta Signaling Pathways TGF-beta Signaling Pathway Thumbnail