Alpha Actinin 3 Antibody (4H7E6)

Novus Biologicals | Catalog # NBP3-15827

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4H7E6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human Alpha Actinin 3 (Q08043). DRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLGEVE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Alpha Actinin 3 Antibody (4H7E6)

Western Blot: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827]

Western Blot: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827]

Western Blot: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Western blot analysis of extracts of various cell lines, using Alpha Actinin 3 Rabbit mAb (NBP3-15827) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Alpha Actinin 3 Antibody (4H7E6)

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] -

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Immunofluorescence analysis of mouse bone marrow cells using Alpha Actinin 3 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Alpha Actinin 3 Antibody (4H7E6)

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] -

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Immunofluorescence analysis of rat bone marrow cells using Alpha Actinin 3 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Alpha Actinin 3 Antibody (4H7E6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Alpha Actinin 3

Alternate Names

actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005

Gene Symbol

ACTN3

Additional Alpha Actinin 3 Products

Product Documents for Alpha Actinin 3 Antibody (4H7E6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Alpha Actinin 3 Antibody (4H7E6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alpha Actinin 3 Antibody (4H7E6)

There are currently no reviews for this product. Be the first to review Alpha Actinin 3 Antibody (4H7E6) and earn rewards!

Have you used Alpha Actinin 3 Antibody (4H7E6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...