Alpha Actinin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55292

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ACTN3(actinin, alpha 3) The peptide sequence was selected from the N terminal of ACTN3. Peptide sequence VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Alpha Actinin 3 Antibody - BSA Free

Western Blot: Alpha Actinin 3 Antibody [NBP1-55292]

Western Blot: Alpha Actinin 3 Antibody [NBP1-55292]

Western Blot: Alpha Actinin 3 Antibody [NBP1-55292] - Human 293T, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody [NBP1-55292]

Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody [NBP1-55292]

Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody [NBP1-55292] - Human skeletal muscle tissue at an antibody concentration of 4-8ug/ml.
Western Blot: Alpha Actinin 3 Antibody [NBP1-55292]

Western Blot: Alpha Actinin 3 Antibody [NBP1-55292]

Western Blot: Alpha Actinin 3 Antibody [NBP1-55292] - Human Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Applications for Alpha Actinin 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alpha Actinin 3

Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This gene expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005

Gene Symbol

ACTN3

UniProt

Additional Alpha Actinin 3 Products

Product Documents for Alpha Actinin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Alpha Actinin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alpha Actinin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Alpha Actinin 3 Antibody - BSA Free and earn rewards!

Have you used Alpha Actinin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...