Catalog Number: 2133
Alternate Names: α-Bgtx, α-BuTX
Biological Activity
Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). Prevents opening of nicotinic receptor-associated ion channels and is selective for α7 receptors over α3β4 receptors (IC50 values are 1.6 nM and > 3 μM respectively).
Technical Data
  • M.Wt:
    7984.14
  • Formula:
    C338H529N97O105S11
  • Sequence:
    IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

    (Modifications: Disulfide bridge between 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65)

  • Solubility:
    Soluble in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    11032-79-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Neuronal acetylcholine receptors that bind α-bungarotoxin with high affinity function as ligand-gated ion channels.
    Zhang et al.
    Neuron, 1994;12:167
  2. Unmasking the functions of the chromaffin cell α7 nicotinic receptor by using short pulses of acetylcholine and selective blockers.
    Lopez et al.
    Proc.Natl.Acad.Sci.USA, 1998;95:14184
Citations:

The citations listed below are publications that use Tocris products. Selected citations for α-Bungarotoxin include:

18 Citations: Showing 1 - 10
Filter your results:

  1. Increasing the Receptor Tyrosine Kinase EphB2 Prevents Amyloid-β-induced Depletion of Cell Surface Glutamate Receptors by a Mechanism That Requires the PDZ-binding Motif of EphB2 and Neuronal Activity.
    Authors: Miyamoto Et al.
    J Neurosci 2016;291:1719
  2. The influence of allosteric modulators and transmembrane mutations on desensitisation and activation of α7 nicotinic acetylcholine receptors.
    Authors: Chatzidaki Et al.
    PLoS One 2015;97:75
  3. Norepinephrine is required to promote wakefulness and for hypocretin-induced arousal in zebrafish.
    Authors: Singh Et al.
    Elife 2015;4
  4. Novel aspects of cholinergic regulation of colonic ion transport.
    Authors: Bader and Diener
    J Biol Chem 2015;3:e00139
  5. Selective Gating of Neuronal Activity by Intrinsic Properties in Distinct Motor Rhythms.
    Authors: Li
    Neurotherapeutics 2015;35:9799
  6. Cholinergic control of γ power in the midbrain spatial attention network.
    Authors: Bryant Et al.
    Proc Natl Acad Sci U S A 2015;35:761
  7. Structurally similar allosteric modulators of α7 nicotinic acetylcholine receptors exhibit five distinct pharmacological effects.
    Authors: Gill-Thind Et al.
    J Biol Chem 2015;290:3552
  8. Molecular blueprint of allosteric binding sites in a homologue of the agonist-binding domain of the α7 nicotinic acetylcholine receptor.
    Authors: Spurny Et al.
    Neuropharmacology 2015;112:E2543
  9. Habenular expression of rare missense variants of the β4 nicotinic receptor subunit alters nicotine consumption.
    Authors: Ślimak Et al.
    Front Hum Neurosci 2014;8:12
  10. The α 7 nicotinic receptor agonist PHA-543613 hydrochloride inhibits Porphyromonas gingivalis-induced expression of interleukin-8 by oral keratinocytes.
    Authors: Macpherson Et al.
    J Neurosci 2014;63:557
  11. Nicotine elicits prolonged calcium signaling along ventral hippocampal axons.
    Authors: Zhong Et al.
    Pharmacol Res Perspect 2013;8:e82719
  12. Nicotine attenuates activation of tissue resident macrophages in the mouse stomach through the β2 nicotinic acetylcholine receptor.
    Authors: Némethova Et al.
    Inflamm Res 2013;8:e79264
  13. Fast silencing reveals a lost role for reciprocal inhibition in locomotion.
    Authors: Moult Et al.
    Neuron 2013;77:129
  14. Acetylcholine and antibodies against the acetylcholine receptor protect neurons and astrocytes against beta-amyloid toxicity.
    Authors: Kamynina Et al.
    Int J Biochem Cell Biol 2013;45:899
  15. CC4, a dimer of cytisine, is a selective partial agonist at α4β2/α6β2 nAChR with improved selectivity for tobacco smoking cessation.
    Authors: Sala Et al.
    Br J Pharmacol 2013;168:835
  16. CHRNA5 as negative regulator of nicotine signaling in normal and cancer bronchial cells: effects on motility, migration and p63 expression.
    Authors: Krais Et al.
    Carcinogenesis 2011;32:1388
  17. Activity-dependent expression of Lmx1b regulates specification of serotonergic neurons modulating swimming behavior.
    Authors: Demarque and Spitzer
    Neuron 2010;67:321
  18. Rosiglitazone inhibits alpha4 nicotinic acetylcholine receptor expression in human lung carcinoma cells through peroxisome proliferator-activated receptor gamma-independent signals.
    Authors: Sun Et al.
    Mol Cancer Ther 2009;8:110
Expand to show all 18 Citations

Have you used α-Bungarotoxin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information