alpha Desmuslin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37909

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MDVSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha Desmuslin Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human smooth muscle shows high expression.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human colon, prostate, smooth muscle and testis using Anti-SYNM antibody NBP2-37909 (A) shows similar protein distribution across tissues to independent antibody NBP2-37892 (B).
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human prostate using Anti-SYNM antibody.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human testis using Anti-SYNM antibody.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human colon using Anti-SYNM antibody.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining in human smooth muscle and liver tissues using anti-SYNM antibody. Corresponding SYNM RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Analysis in human skeletal muscle and liver tissues using NBP2-37909 antibody. Corresponding SYNM RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human heart muscle, liver, prostate and skeletal muscle using Anti-SYNM antibody NBP2-37909 (A) shows similar protein distribution across tissues to independent antibody NBP2-37892 (B).
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human liver shows no cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909]

Immunohistochemistry-Paraffin: alpha Desmuslin Antibody [NBP2-37909] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Applications for alpha Desmuslin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha Desmuslin

alpha Desmuslin is encoded by this gene is an intermediate filament (IF) family member. IF proteins are cytoskeletal proteins that confer resistance to mechanical stress and are encoded by a dispersed multigene family. This protein has been found to form a linkage between desmin, which is a subunit of the IF network, and the extracellular matrix, and provides an important structural support in muscle. Two alternatively spliced variants encoding different isoforms have been described for this gene.

Alternate Names

desmuslin, DMNEC 1.4.99.1, EC 2.6.1.16, KIAA0353synemin beta, SYNDesmuslin, synemin, synemin alpha, synemin, intermediate filament protein

Gene Symbol

SYNM

UniProt

Additional alpha Desmuslin Products

Product Documents for alpha Desmuslin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha Desmuslin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha Desmuslin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha Desmuslin Antibody - BSA Free and earn rewards!

Have you used alpha Desmuslin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...