Alpha Dystroglycan Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59781

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Alpha Dystroglycan. Peptide Sequence AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Alpha Dystroglycan Antibody - BSA Free

Western Blot: Alpha Dystroglycan Antibody [NBP1-59781]

Western Blot: Alpha Dystroglycan Antibody [NBP1-59781]

Western Blot: Alpha Dystroglycan Antibody [NBP1-59781] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Alpha Dystroglycan Antibody [NBP1-59781]

Immunohistochemistry: Alpha Dystroglycan Antibody [NBP1-59781]

Immunohistochemistry: Alpha Dystroglycan Antibody [NBP1-59781] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Alpha Dystroglycan Antibody [NBP1-59781]

Western Blot: Alpha Dystroglycan Antibody [NBP1-59781]

Western Blot: Alpha Dystroglycan Antibody [NBP1-59781] - Human Stomach, concentration 0.2-1 ug/ml.

Applications for Alpha Dystroglycan Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alpha Dystroglycan

The dystroglycan complex is a membrane-spanning complex composed of two subunits, alpha- and beta-dystroglycan. Alpha-dystroglycan is a cell surface peripheral membrane protein which binds to the extracellular matrix (ECM), whereas beta-dystroglycan is an integral membrane protein which anchors alpha-dystroglycan to the cell membrane. The dystroglycan complex provides a tight link between the ECM and cell membrane. Dysfunction of the dystroglycan complex has commonly been implicated in the molecular pathogenesis of severe forms of hereditary neuromuscular diseases, including Duchenne muscular dystrophy, Fukuyama-type congenital muscular dystrophy and sarcoglycanopathy (1). Human dystroglycan is expressed in a variety of fetal and adult tissues. Data suggest that muscle and non-muscle isoforms of dystroglycan differ by carbohydrate moieties but not protein sequence. Therefore variable glycosylation of the conserved protein core might modulate laminin binding (2). beta-dystroglycan has been localized to microvilli structures in a number of cell types where it associates with the cytoskeletal adaptor ezrin, through which it is able to modulate the actin cytoskeleton and induce peripheral filopodia and microvilli (3)

Alternate Names

A3a, AGRNR, DAG156DAG, dystroglycan, dystroglycan 1 (dystrophin-associated glycoprotein 1), Dystrophin-associated glycoprotein 1

Gene Symbol

DAG1

UniProt

Additional Alpha Dystroglycan Products

Product Documents for Alpha Dystroglycan Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Alpha Dystroglycan Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alpha Dystroglycan Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Alpha Dystroglycan Antibody - BSA Free and earn rewards!

Have you used Alpha Dystroglycan Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...