Alpha Fodrin Antibody (9H5V8)

Novus Biologicals | Catalog # NBP3-16131

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9H5V8 expressed in HEK293
View all Alpha Fodrin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Alpha Fodrin Antibody (9H5V8)

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131]

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131]

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Analysis of extracts of various cell lines, using Alpha Fodrin Rabbit mAb (NBP3-16131) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131]

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131]

Western Blot: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Analysis of extracts of HeLa cells, using Alpha Fodrin Rabbit mAb (NBP3-16131) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human thyroid cancer tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded mouse colon tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human colon carcinoma tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded rat colon tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded human liver cancer tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Alpha Fodrin Antibody (9H5V8)

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] -

Immunohistochemistry: Alpha Fodrin Antibody (9H5V8) [NBP3-16131] - Immunohistochemistry analysis of Alpha Fodrin in paraffin-embedded rat kidney tissue using Alpha Fodrin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Alpha Fodrin Antibody (9H5V8)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Alpha Fodrin

SPTAN1/Alpha II-spectrin is one of two polypeptide chains (alpha and beta) that are part of the fodrin tetramer. Fodrin functions to link actin filaments to the plasma membrane and is a major neuronal cytoskeletal protein. Fodrin has been linked to neurogenerative and autoimmune diseases.

Alternate Names

Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2

Gene Symbol

SPTAN1

Additional Alpha Fodrin Products

Product Documents for Alpha Fodrin Antibody (9H5V8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Alpha Fodrin Antibody (9H5V8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alpha Fodrin Antibody (9H5V8)

There are currently no reviews for this product. Be the first to review Alpha Fodrin Antibody (9H5V8) and earn rewards!

Have you used Alpha Fodrin Antibody (9H5V8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies