Aly Antibody (6I4T10)

Novus Biologicals | Catalog # NBP3-16372

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6I4T10 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 158-257 of human AlyREF (Q86V81). DALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aly Antibody (6I4T10)

Western Blot: Aly Antibody (6I4T10) [NBP3-16372]

Western Blot: Aly Antibody (6I4T10) [NBP3-16372]

Western Blot: Aly Antibody (6I4T10) [NBP3-16372] - Western blot anTHOC4/AlyREFsis of extracts of various cell lines, using THOC4/AlyREF Rabbit mAb (NBP3-16372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded rat testis tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded mouse heart tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded human spleen tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded mouse colon tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded mouse brain tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Aly Antibody (6I4T10)

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] -

Immunohistochemistry: Aly Antibody (6I4T10) [NBP3-16372] - Immunohistochemistry analysis of Aly in paraffin-embedded human esophagus tissue using Aly Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Aly Antibody (6I4T10)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aly

Pre-mRNA splicing plays an important role in regulation of gene expression. During the splicing process, specific proteins are recruited to the mRNA and assembled into a complex of mRNA-protein near the exon-exon junction. This complex is termed the mRNA-protein complex (mRNP) or the exon-exon junction complex. The proteins that are found in this complex include: Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK.1-5 Aly (also known as mREF1-I) is the mammalian homologue of the yeast mRNA export factor Yra1p.6-7 It is a 233 amino acid RNAbinding protein that contains a RNA-binding domain and is recruited to the mRNP complexes during the splicing. Excess of recombinant expression of Aly in the cells increases both the rate and efficiency of spliced and unspliced mRNA export (in vivo) from the nucleus to the cytoplasm. In contrast to the Y14 protein, Aly is dissociated from the mRNAs after the export to the cytoplasm.1, 5-6

Alternate Names

Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, Tho4, Transcriptional coactivator Aly/REF

Gene Symbol

ALYREF

Additional Aly Products

Product Documents for Aly Antibody (6I4T10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aly Antibody (6I4T10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aly Antibody (6I4T10)

There are currently no reviews for this product. Be the first to review Aly Antibody (6I4T10) and earn rewards!

Have you used Aly Antibody (6I4T10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...