AP1M2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92832
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 164-423 of human AP1M2 (NP_005489.2). IKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for AP1M2 Antibody - BSA Free
Western Blot: AP1M2 AntibodyBSA Free [NBP2-92832]
Western Blot: AP1M2 Antibody [NBP2-92832] - Analysis of extracts of various cell lines, using AP1M2.Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] -
Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] - Immunofluorescence analysis of U-2 OS cells using AP1M2 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] -
Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] - Immunofluorescence analysis of L929 cells using AP1M2 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] -
Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] - Immunofluorescence analysis of H9c2 cells using AP1M2 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] -
Immunocytochemistry/ Immunofluorescence: AP1M2 Antibody - BSA Free [NBP2-92832] - Confocal immunofluorescence analysis of U2OS cells using AP1M2 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.Applications for AP1M2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: AP1M2
Alternate Names
Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Gene Symbol
AP1M2
Additional AP1M2 Products
Product Documents for AP1M2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AP1M2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for AP1M2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review AP1M2 Antibody - BSA Free and earn rewards!
Have you used AP1M2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...