Catalog Number: 4804
Biological Activity
Acid-sensing ion channel 3 (ASIC3) channel blocker (IC50 values are 63 and 175 nM for homomeric rat and human ASIC3 channels). Also inhibits NaV1.8 and NaV1.2 channels (IC50 values are 55 and 114 nM respectively). Demonstrates analgesic properties against acid-induced and inflammatory pain.
Technical Data
  • M.Wt:
    4561.06
  • Formula:
    C196H280N54O61S6
  • Sequence:
    GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD

    (Modifications: Disulfide bridge between 4-37, 6-30, 20-38)

  • Solubility:
    Soluble to 5 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    713544-47-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Acid-sensing ion channels (ASICs) as pharmacological targets for neurodegenerative diseases.
    Xiong et al.
    Curr.Opin.Pharmacol., 2008;8:25
  2. Reversal of acid-induced and inflammatory pain by the selective ASIC3 inhibitor, APETx2.
    Karczewski et al.
    Br.J.Pharmacol., 2010;161:950
  3. A new sea anemone peptide, APETx2, inhibits ASIC3, a major acid-sensitive channel in sensory neurons.
    Diochot et al.
    EMBO J., 2004;23:1516
  4. Inhibition of voltage-gated Na(+) currents in sensory neurones by the sea anemone toxin APETx2.
    Blanchard et al.
    Br.J.Pharmacol., 2012;165:2167
  5. A natural point mutation changes both target selectivity and mechanism of action of sea anemone toxins.
    Peigneur et al.
    FASEB J., 2012;26:5141

Have you used APETx2?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information