APETx2

Catalog # Availability Size / Price Qty
4804/100U
Cat.No. 4804 - APETx2 | Gly-Thr-Ala-Cys-Ser-Cys-Gly-Asn-Ser-Lys-Gly-Ile-Tyr-Trp-Phe-Tyr-Arg-Pro-ser-Cys-Pro-Thr-Asp-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Arg-Tyr-Phe-Leu-Gly-Thr-Cys-Cys-Thr-Pro-Ala-Asp | CAS No. 713544-47-9
1 Image
Description: ASIC3 channel blocker
Product Details
Reviews

Biological Activity

Acid-sensing ion channel 3 (ASIC3) channel blocker (IC50 values are 63 and 175 nM for homomeric rat and human ASIC3 channels). Also inhibits NaV1.8 and NaV1.2 channels (IC50 values are 55 and 114 nM respectively). Demonstrates analgesic properties against acid-induced and inflammatory pain.

Technical Data

M.Wt:
4561.06
Formula:
C196H280N54O61S6
Sequence:
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD

(Modifications: Disulfide bridge between 4-37, 6-30, 20-38)

Solubility:
Soluble to 5 mg/ml in water
Storage:
Store at -20°C
CAS No:
713544-47-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for APETx2

There are currently no reviews for this product. Be the first to review APETx2 and earn rewards!

Have you used APETx2?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.